DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Stam and wdfy1

DIOPT Version :9

Sequence 1:	NP_477448.1	Gene:	Stam / 34505	FlyBaseID:	FBgn0027363	Length:	689	Species:	Drosophila melanogaster
Sequence 2:	NP_001007058.2	Gene:	wdfy1 / 474326	ZFINID:	ZDB-GENE-041024-4	Length:	410	Species:	Danio rerio

Alignment Length:	53	Identity:	11/53 - (20%)
Similarity:	22/53 - (41%)	Gaps:	18/53 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   159 AAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKTGSVASTGTASAYPSLY 211
            |..:||:..|::..::     :.|.:.||.:.|             ..:||:|
Zfish    30 AVLIPKEDGVITVSED-----RTIRVWLKRDSG-------------QYWPSIY 64

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Stam	NP_477448.1	VHS_STAM	10..154	CDD:239625
		SH3_STAM	235..288	CDD:212754
		GAT	340..412	CDD:281166
wdfy1	NP_001007058.2	WD40	16..275	CDD:295369	11/53 (21%)
		WD40	20..394	CDD:225201	11/53 (21%)
		WD40 repeat	28..67	CDD:293791	11/53 (21%)
		WD40 repeat	71..111	CDD:293791
		WD40 repeat	118..153	CDD:293791
		WD40 repeat	158..196	CDD:293791
		WD40 repeat	202..239	CDD:293791
		WD40 repeat	245..269	CDD:293791
		FYVE_WDFY1	279..354	CDD:277295
		WD40 repeat	321..363	CDD:293791
		WD40	355..394	CDD:197651
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574148
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930