DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and grb2b

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_998200.1 Gene:grb2b / 406308 ZFINID:ZDB-GENE-040426-1975 Length:217 Species:Danio rerio


Alignment Length:237 Identity:59/237 - (24%)
Similarity:97/237 - (40%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VASRDFETEFRRLLAKAQPKVSLKMRQVLK--------NWAENDYK---NDRELDLIPALYAKLR 138
            :|..||:       |.|..::|.|..::||        ||    ||   |.:: ..||..|.:::
Zfish     4 IAKYDFK-------ATADDELSFKRGEILKVLNEECDQNW----YKAELNGKD-GFIPKNYIEMK 56

  Fly   139 QEGYDFKNLGDKTSKTVAEK----AAALPKDPNVVSSQQEEDDIAKAIELS--------LKENKG 191
            ...:.|..:....::.:..|    .|.|.::     |:....|.:.:::..        |::..|
Zfish    57 AHPWFFGRIPRARAEEILNKQRHDGAFLIRE-----SESAPGDFSLSVKFGNDVQHFKVLRDGAG 116

  Fly   192 S-----PKTGSVAS------TGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALYDFEA 245
            .     .|..|:..      |.:.|....::           ..:....| ..|..|:||:||:.
Zfish   117 KYFLWVVKFNSLNELVDYHRTTSVSRNQQIF-----------LRDIEQVP-QHPTYVQALFDFDP 169

  Fly   246 AEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVT 287
            .|:.||.|..|:.|.|||:||||||||......|:||.|:||
Zfish   170 QEDGELGFRRGDFIQVLDNSDPNWWKGACHGQTGMFPRNYVT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 18/79 (23%)
SH3_STAM 235..288 CDD:212754 28/53 (53%)
GAT 340..412 CDD:281166
grb2bNP_998200.1 SH3_GRB2_N 1..56 CDD:212879 17/63 (27%)
SH2_Grb2_like 56..150 CDD:199828 12/109 (11%)
SH3_GRB2_C 160..212 CDD:212882 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.