DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and sh3gl3b

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_956475.2 Gene:sh3gl3b / 393150 ZFINID:ZDB-GENE-040121-4 Length:386 Species:Danio rerio


Alignment Length:364 Identity:88/364 - (24%)
Similarity:132/364 - (36%) Gaps:105/364 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DVEKATSETNTNDNWSLILDVCDK----VTTNP--RLAKDCLKAVMRRMGHTD----PHV----- 62
            |.|..:.|..|.....||||:..|    :..||  |.....|..|.|..||..    |..     
Zfish    30 DEEFLSMERKTEITHKLILDIVPKTIGYLQPNPAYRAKLSMLSTVSRIRGHVKAVGYPQTEGILG 94

  Fly    63 --VMQAITLLDALSN------NCGKPLHLEVASRD---------FETEFRRLLAKAQPKVSLKMR 110
              ::|..:.|.|.|.      ..|:.|.....:||         |....:.|..|...::...:|
Zfish    95 DCMLQYGSELGAESGFGFALLEMGEALKQVAQARDCMDVRVKRAFIDPLQSLQQKELKEIGFHLR 159

  Fly   111 QVLKNWAENDYKNDRELDLIPALYAKLRQEGYDFKNLGDK--TSKTVAEKAA--ALPKDPNVV-- 169
            ::.....:.|||..|:        .|:...  :.|...||  .||.:||:..  .|.||...:  
Zfish   160 KLEGRRLDFDYKKRRK--------GKIADS--EIKKAFDKFEESKEMAERCMFNLLEKDVQRMQH 214

  Fly   170 -------------SSQQEEDDIAKAIELSLKENKGSPK----TGSVASTGTASAYPSLYPSFAGT 217
                         .|.|..:::...::..:::....||    :.|||||   ..|..:| .|: |
Zfish   215 LSGLLEAVIDYHRQSSQILENLRSNLQTKIRDASNKPKREFASKSVAST---VCYSDIY-GFS-T 274

  Fly   218 GSSAPSAEA------SSAPAP----EPRKV-------------------------RALYDFEAAE 247
            .||.||::.      |...||    .|.:|                         :|||.|:|..
Zfish   275 CSSGPSSDTEITEALSEKYAPVVVHRPEQVTIKTPTTDKPASINDRAPPLDQPCCQALYSFQAEN 339

  Fly   248 ENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286
            :.||.|..|:||.:....|.||::|..:...||||.|:|
Zfish   340 QGELGFKEGDIIILTSQIDENWYEGMIRGQSGLFPMNYV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 39/174 (22%)
SH3_STAM 235..288 CDD:212754 22/77 (29%)
GAT 340..412 CDD:281166
sh3gl3bNP_956475.2 BAR_Endophilin_A 25..247 CDD:153276 47/226 (21%)
SH3_Endophilin_A 327..381 CDD:212737 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.