DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and sh3gl1b

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_021333879.1 Gene:sh3gl1b / 378838 ZFINID:ZDB-GENE-031001-6 Length:367 Species:Danio rerio


Alignment Length:324 Identity:73/324 - (22%)
Similarity:126/324 - (38%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIFGQSSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRLA--KDCLKAVMRRMGHTDPHVV 63
            ||.:|:         :...|||..   ..:::|.:.:   .|||  ||.|...:::         
Zfish    97 MGKYGR---------ELGEETNFG---GALMEVGESM---KRLAEVKDSLDIDVKQ--------- 137

  Fly    64 MQAITLLDALSNNCGKPL-----HL-EVASRDFETEFRRLLAKAQPKV-SLKMRQVLKNWAENDY 121
                ..:|.|...|.|.|     || ::..|..:.::::   |.|.|: ..::||.|:.:.|:  
Zfish   138 ----NFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKK---KRQGKIPDEELRQALEKFHES-- 193

  Fly   122 KNDRELDLIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQ--------QEEDDI 178
            |...|:.:...|                   :|..|:.:.|   .::|.||        |..|::
Zfish   194 KEVAEISMYNLL-------------------ETDIEQVSQL---SSLVESQLQYHRQAVQILDEL 236

  Fly   179 AKAIELSLKENKGSPK---------------TGSVASTG-TASAYPSL-----YPSFAGTGSSAP 222
            :..:...:|:.:..|:               |...::.| |.|:.|.:     |..|....:..|
Zfish   237 SDKLRDRMKDAQTRPRKEYIPKPKPVIDFGETNEQSNGGYTPSSAPPMRNAESYHQFGRITTRKP 301

  Fly   223 SAEASSAPAPEPRKVRALYDFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286
            ...|..|..      :||||||...|.||.|..|:||.:.:..|.||::|..:...|.||.|:|
Zfish   302 RLPAEQACC------KALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 28/152 (18%)
SH3_STAM 235..288 CDD:212754 22/52 (42%)
GAT 340..412 CDD:281166
sh3gl1bXP_021333879.1 BAR_Endophilin_A 25..247 CDD:153276 40/204 (20%)
SH3_Endophilin_A 309..362 CDD:212737 22/57 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.