DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and drk

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:93/233 - (39%) Gaps:59/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VASRDFETEFRRLLAKAQPKVSLKMRQVLK--------NW--AENDYKNDRELDLIPALYAKLRQ 139
            :|..||.       |.|..::|.:..|:||        ||  ||.|.|.    .|||:.|.:::.
  Fly     4 IAKHDFS-------ATADDELSFRKTQILKILNMEDDSNWYRAELDGKE----GLIPSNYIEMKN 57

  Fly   140 EGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKTGSVASTGTA 204
            ..:.:    .:.::..|||         ::|::.|     .|..:.:.|:.....:.||......
  Fly    58 HDWYY----GRITRADAEK---------LLSNKHE-----GAFLIRISESSPGDFSLSVKCPDGV 104

  Fly   205 SAYPSLYPS-------------------FAGTGSSAPSAEASSAP-APEPRKVRALYDFEAAEEN 249
            ..:..|..:                   :..|.|.:.|.:..... .||...|:|||||...|..
  Fly   105 QHFKVLRDAQSKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESG 169

  Fly   250 ELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVT 287
            ||.|..|::|.|.|.||.|||.|.....:|:||:.:||
  Fly   170 ELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 19/78 (24%)
SH3_STAM 235..288 CDD:212754 25/53 (47%)
GAT 340..412 CDD:281166
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 18/59 (31%)
SH2_Grb2_like 56..149 CDD:199828 13/110 (12%)
SH3_GRB2_like_C 156..208 CDD:212739 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.