DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Wdfy2

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_006252239.1 Gene:Wdfy2 / 305956 RGDID:1307337 Length:400 Species:Rattus norvegicus


Alignment Length:169 Identity:33/169 - (19%)
Similarity:63/169 - (37%) Gaps:50/169 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 SKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKTGSVASTGTASAYPSLYPSFAG 216
            |:.|...|..:||:..|:|..::     :.:.:.||.:.|             ..:||:|     
  Rat    23 SQEVVNMAVIVPKEEGVISVSED-----RTVRVWLKRDSG-------------QYWPSIY----- 64

  Fly   217 TGSSAPSAEASSAPAPEPRKVR------ALYDFEAAEE-NELT---------------FFAGEII 259
              .:.||..:..:..||.|::.      .:.:|..:|: |::|               .|..|:.
  Rat    65 --HAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMVLFVLELE 127

  Fly   260 HVL---DDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPE 295
            .||   .|....|....:.:..|.:.::.|.:.|..|.|
  Rat   128 WVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 1/1 (100%)
SH3_STAM 235..288 CDD:212754 13/77 (17%)
GAT 340..412 CDD:281166
Wdfy2XP_006252239.1 WD40 16..272 CDD:295369 33/169 (20%)
WD40 18..394 CDD:225201 33/169 (20%)
WD40 repeat 27..64 CDD:293791 10/54 (19%)
WD40 repeat 72..132 CDD:293791 11/59 (19%)
WD40 repeat 159..197 CDD:293791 3/8 (38%)
WD40 repeat 203..240 CDD:293791
WD40 repeat 245..283 CDD:293791
FYVE_WDFY1_like 279..348 CDD:277258
WD40 repeat 321..363 CDD:293791
WD40 358..394 CDD:197651
WD40 repeat 369..395 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.