DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Wdfy1

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001380913.1 Gene:Wdfy1 / 301549 RGDID:1305996 Length:410 Species:Rattus norvegicus


Alignment Length:130 Identity:26/130 - (20%)
Similarity:53/130 - (40%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKT 195
            |.|.:|:  ||:          :.....|..:||:..|:::.::     :.|.:.||.:.|    
  Rat    14 PVLLSKI--EGH----------QDAVTAALLIPKEDGVITASED-----RTIRVWLKRDSG---- 57

  Fly   196 GSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKV------RALYDFEAAEE-NELTF 253
                     ..:||:|.:.|       |..::.|...:.|:|      .|:.:|..:|: |::.|
  Rat    58 ---------QYWPSIYHTMA-------SPCSAMAYHHDSRRVFVGQDNGAVMEFHVSEDFNKMNF 106

  Fly   254  253
              Rat   107  106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 5/22 (23%)
SH3_STAM 235..288 CDD:212754 7/26 (27%)
GAT 340..412 CDD:281166
Wdfy1NP_001380913.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.