DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and GRB2

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_002077.1 Gene:GRB2 / 2885 HGNCID:4566 Length:217 Species:Homo sapiens


Alignment Length:240 Identity:63/240 - (26%)
Similarity:96/240 - (40%) Gaps:69/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VASRDFETEFRRLLAKAQPKVSLKMRQVLK--------NWAENDYK---NDRELDLIPALYAKLR 138
            :|..||:       |.|..::|.|...:||        ||    ||   |.:: ..||..|.:::
Human     4 IAKYDFK-------ATADDELSFKRGDILKVLNEECDQNW----YKAELNGKD-GFIPKNYIEMK 56

  Fly   139 QEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSP-------KTG 196
            ...:.|    .|..:..||:          :.|:|..|.     ...::|::.:|       |.|
Human    57 PHPWFF----GKIPRAKAEE----------MLSKQRHDG-----AFLIRESESAPGDFSLSVKFG 102

  Fly   197 S------VASTGTASAYPSLYPSFAGTGSSAPSAEASSAP-------------APEPRKVRALYD 242
            :      |...| |..|......|...........::|..             ..:|..|:||:|
Human   103 NDVQHFKVLRDG-AGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFD 166

  Fly   243 FEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVT 287
            |:..|:.||.|..|:.|||:|:||||||||......|:||.|:||
Human   167 FDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 19/79 (24%)
SH3_STAM 235..288 CDD:212754 28/53 (53%)
GAT 340..412 CDD:281166
GRB2NP_002077.1 SH3_GRB2_N 1..56 CDD:212879 17/63 (27%)
SH2_Grb2_like 56..150 CDD:199828 17/113 (15%)
SH3_GRB2_C 160..212 CDD:212882 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.