DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and mug137

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_588493.1 Gene:mug137 / 2539113 PomBaseID:SPCC1919.11 Length:420 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:75/326 - (23%)
Similarity:124/326 - (38%) Gaps:88/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VASRDFETEFRRLLAKAQPKVSLKMRQVLKNWAENDYKNDRELDLIPALYAKLRQEGYDFKNLGD 149
            |.::||.:..::|.::.|...||    :.|::.|....:..|.|:..|||.            .:
pombe   126 VQAKDFHSARKKLESRRQAYESL----LQKSFKEKKEDSRLEEDIRLALYK------------FE 174

  Fly   150 KTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKT------------------G 196
            ::::.|..:..|| ||......||..:.|...:.. .||:.|...|                  .
pombe   175 ESTEQVKNRMIAL-KDVEADQYQQLTELIVYELNF-FKESTGILNTIFNSQNSLTPQKKIQSSER 237

  Fly   197 SVASTGTASAY-PSLYPSFAGTGSSAPSAEASSAPAPEPRK--------VRALYDFEAAEENELT 252
            ||.:...||.. |||...|..|.:   :.:.|..|...|::        |:|:|.|....|.||.
pombe   238 SVENEFLASPMDPSLSKLFTKTTN---TEKISPTPFSTPKRKSKKETVFVKAIYSFTGRNEKELD 299

  Fly   253 FFAGEIIHVLDDSDPNWWKG--YNQRGE-----GLFPSNFVTADLSVDPERLDINQQHKSAAAAG 310
            ...|::|.|.:...|:|:.|  .|.:.|     |:||.|:.|....     |.:.:.|::     
pombe   300 LHTGDVIQVSEQLGPDWYMGEKVNSKAEKLGNSGMFPVNYCTRIYD-----LHVQKSHET----- 354

  Fly   311 QRELDSAAALQQKTEAAAAAAAAQPVE----IDESKIDRLLHLLHEANPEDPSQDSDEMLQLEQE 371
             |.|:.|.::::       ..:..|.:    |.:|.|..|..|           |||..|...|.
pombe   355 -RSLERARSIRR-------IVSDDPRDYCSPIKQSPIQNLKFL-----------DSDNSLLSSQN 400

  Fly   372 V 372
            |
pombe   401 V 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 14/68 (21%)
SH3_STAM 235..288 CDD:212754 19/67 (28%)
GAT 340..412 CDD:281166 10/33 (30%)
mug137NP_588493.1 BAR_MUG137_fungi 17..230 CDD:153277 26/121 (21%)
SH3 280..341 CDD:214620 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45929
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.