DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Tom1

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001129731.1 Gene:Tom1 / 21968 MGIID:1338026 Length:516 Species:Mus musculus


Alignment Length:440 Identity:97/440 - (22%)
Similarity:174/440 - (39%) Gaps:127/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRLAKDCLKAVMRR-MGHTDPHVVMQAITLL 70
            |||....:||||..:..:::|:|.:::||.:.......||..:||.:| ||:.:.|.||.|:|:|
Mouse    10 SSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDAFRAVKKRIMGNKNFHEVMLALTVL 74

  Fly    71 DALSNNCGKPLHLEVASRDF--ETEFRRLLAKAQPK--VSLKMRQVLKNWAENDYKNDRELDLIP 131
            :....|||...|:.||::||  ....|.:|.|..|.  |..|:..::::||: .:::..:|..:.
Mouse    75 ETCVKNCGHRFHVLVANQDFVENVLVRTILPKNNPPTIVHDKVLNLIQSWAD-AFRSSPDLTGVV 138

  Fly   132 ALYAKLRQEGYDFKNLG-DKTS------KTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKEN 189
            |:|..||::|.:|.... |..|      :||..  :..|...|.|||                  
Mouse   139 AVYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFN--SETPSRQNSVSS------------------ 183

  Fly   190 KGSPKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALYDFEAAEENELTFF 254
             .:.:.|.::...|....|::.|             ..|...|.|.::..|       .:||...
Mouse   184 -NTSQRGDLSQHATPLPTPAVLP-------------GDSPITPTPEQIGKL-------RSELEMV 227

  Fly   255 AGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLDINQQHKSAAAAGQRELDSAAA 319
            :|.:            :..::....|.|:....|||.:..|   :|:              :..|
Mouse   228 SGNV------------RVMSEMLTELVPTQVEPADLELLQE---LNR--------------TCRA 263

  Fly   320 LQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPEDPSQDSDEMLQLEQEVHQMGPLIDAELE 384
            :||                      |:|.|:...:.|   |.::|:|.:...::.    :....|
Mouse   264 MQQ----------------------RILELIPRISNE---QLTEELLMINDNLNN----VFLRHE 299

  Fly   385 RVDR-------KHAQLTQLSSDLVDAINLYHTLMRDDRAAAGHFAAAAGG 427
            |.:|       |.:...:|::||:|        |..|.||..:.::...|
Mouse   300 RFERFRTGQTAKASSEAELATDLID--------MGPDPAATNNLSSQLAG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 46/155 (30%)
SH3_STAM 235..288 CDD:212754 6/52 (12%)
GAT 340..412 CDD:281166 15/78 (19%)
Tom1NP_001129731.1 VHS_Tom1 12..152 CDD:239623 44/140 (31%)
GAT_TOM1 214..308 CDD:260094 25/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.