DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Sh3gl3

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:XP_030098123.1 Gene:Sh3gl3 / 20408 MGIID:700011 Length:361 Species:Mus musculus


Alignment Length:325 Identity:77/325 - (23%)
Similarity:124/325 - (38%) Gaps:72/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VEKATSETNTNDNWSLILDVCD---------KVTTNPR---LAKDCLKAVMRRMGHTDPH----- 61
            :.|||.....|..:...|.:.:         |.|..|:   |..||:....:.:|.....     
Mouse    65 LSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLV 129

  Fly    62 VVMQAITLL----DALSNNCGKPLHLEVASRDFETEFRRLLAKAQPKVSLKMRQVLKNWAENDYK 122
            .|.:|:.|:    |:|..|         ..:.|....:.|..|...::...:|::.....:.|||
Mouse   130 DVGEALKLMAEVKDSLDIN---------VKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYK 185

  Fly   123 NDRELDLIPALYAKLRQEGYDFKNLGDKTSKTVAEKAA--ALPKDPNVVSS-------------- 171
            . |.:..||.  .::||....|:.     ||.:||::.  .|..|...||.              
Mouse   186 K-RRVGKIPE--EEIRQAVEKFEE-----SKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQ 242

  Fly   172 -----QQEEDDIAKAIELSLKENKGS--PKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSA 229
                 |:.:..:...|.|:.|..|..  ||..:::||......||       :.|..|..:   .
Mouse   243 STEILQELQSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPS-------SSSKTPGTD---T 297

  Fly   230 PAPEPRKVRALYDFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDP 294
            |:.:| ..|.|||||...|.||.|..|:||.:.:..|.||::|..:...|.||.|:|...:.:.|
Mouse   298 PSDQP-CCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPLPP 361

  Fly   295  294
            Mouse   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 32/160 (20%)
SH3_STAM 235..288 CDD:212754 22/52 (42%)
GAT 340..412 CDD:281166
Sh3gl3XP_030098123.1 BAR_Endophilin_A3 39..261 CDD:153299 41/212 (19%)
SH3_Endophilin_A 302..356 CDD:212737 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.