DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Sh3gl1

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_038692.1 Gene:Sh3gl1 / 20405 MGIID:700010 Length:368 Species:Mus musculus


Alignment Length:293 Identity:78/293 - (26%)
Similarity:119/293 - (40%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ETNTNDNWSLILDVCDKVTTNPRLA--KDCLKAVMRRMGHTDPHVVMQAITLLDALSNNCGKPL- 81
            |:|..|   .:||..:.:   .|||  ||.|...:::             ..:|.|.|.|.|.| 
Mouse   107 ESNFGD---ALLDAGESM---KRLAEVKDSLDIEVKQ-------------NFIDPLQNLCDKDLK 152

  Fly    82 ----HL-EVASRDFETEFRRLLAKAQPKV-SLKMRQVL------KNWAENDYKNDRELD------ 128
                || ::..|..:.::::   |.|.|: ..::||.|      |..||....|..|.|      
Mouse   153 EIQHHLKKLEGRRLDFDYKK---KRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQ 214

  Fly   129 ---LIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKE-- 188
               |:.|.....||.....:.|.||..:.|.| |::.||       ::.:....:..||...|  
Mouse   215 LSALVDAQLDYHRQAVQILEELADKLKRRVRE-ASSRPK-------REFKPRPREPFELGELEQP 271

  Fly   189 NKGSPKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALYDFEAAEENELTF 253
            |.|.|  .:.|...|||:      ||..:.........|..|..:| ..:||||||...:.||.|
Mouse   272 NGGFP--CAPAPKITASS------SFRSSDKPIRMPSKSMPPLDQP-SCKALYDFEPENDGELGF 327

  Fly   254 FAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286
            ..|::|.:.:..|.||::|......|.||.::|
Mouse   328 REGDLITLTNQIDENWYEGMLHGQSGFFPLSYV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 39/157 (25%)
SH3_STAM 235..288 CDD:212754 19/52 (37%)
GAT 340..412 CDD:281166
Sh3gl1NP_038692.1 Membrane-binding amphipathic helix. /evidence=ECO:0000250 1..21
BAR_Endophilin_A 25..247 CDD:153276 41/162 (25%)
Required for dimerization upon membrane association. /evidence=ECO:0000250 60..87
Interaction with ARC. /evidence=ECO:0000250 218..254 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..307 19/78 (24%)
SH3_Endophilin_A 309..363 CDD:212737 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.