Sequence 1: | NP_477448.1 | Gene: | Stam / 34505 | FlyBaseID: | FBgn0027363 | Length: | 689 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509342.1 | Gene: | sem-5 / 181055 | WormBaseID: | WBGene00004774 | Length: | 228 | Species: | Caenorhabditis elegans |
Alignment Length: | 240 | Identity: | 63/240 - (26%) |
---|---|---|---|
Similarity: | 91/240 - (37%) | Gaps: | 73/240 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 VASRDFETEFRRLLAKAQPKVSLKMRQVLK--NWAENDYKNDRELD----LIPALYAKLRQEGYD 143
Fly 144 FKNLGDKTSKTVAEKAAALPKDPNV----------VSSQQE-------EDDIAK----------- 180
Fly 181 ---AIEL-SLKENKGSPKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALY 241
Fly 242 DFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Stam | NP_477448.1 | VHS_STAM | 10..154 | CDD:239625 | 19/74 (26%) |
SH3_STAM | 235..288 | CDD:212754 | 23/52 (44%) | ||
GAT | 340..412 | CDD:281166 | |||
sem-5 | NP_509342.1 | SH3_GRB2_like_N | 2..53 | CDD:212738 | 16/55 (29%) |
SH2_Grb2_like | 56..151 | CDD:199828 | 21/122 (17%) | ||
SH3_GRB2_like_C | 158..210 | CDD:212739 | 23/51 (45%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R571 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |