DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and sem-5

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:240 Identity:63/240 - (26%)
Similarity:91/240 - (37%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VASRDFETEFRRLLAKAQPKVSLKMRQVLK--NWAENDYKNDRELD----LIPALYAKLRQEGYD 143
            ||..||:       |.:..::|.|....||  |..|:.:....|||    .||:.|.::.:..: 
 Worm     4 VAEHDFQ-------AGSPDELSFKRGNTLKVLNKDEDPHWYKAELDGNEGFIPSNYIRMTECNW- 60

  Fly   144 FKNLGDKTSKTVAEKAAALPKDPNV----------VSSQQE-------EDDIAK----------- 180
              .||    |.....|..|.|.|.|          .||..|       :|.:..           
 Worm    61 --YLG----KITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRFQDSVQHFKVLRDQNGKY 119

  Fly   181 ---AIEL-SLKENKGSPKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALY 241
               |::. ||.|.....:|.||:.|.|.                     ..|....|.:.|:||:
 Worm   120 YLWAVKFNSLNELVAYHRTASVSRTHTI---------------------LLSDMNVETKFVQALF 163

  Fly   242 DFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286
            ||...|..||.|..|::|.:::..|||||:|......|:||||:|
 Worm   164 DFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 19/74 (26%)
SH3_STAM 235..288 CDD:212754 23/52 (44%)
GAT 340..412 CDD:281166
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738 16/55 (29%)
SH2_Grb2_like 56..151 CDD:199828 21/122 (17%)
SH3_GRB2_like_C 158..210 CDD:212739 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.