DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and TOM1L2

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001337261.1 Gene:TOM1L2 / 146691 HGNCID:11984 Length:536 Species:Homo sapiens


Alignment Length:358 Identity:80/358 - (22%)
Similarity:152/358 - (42%) Gaps:81/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRLAKDCLKAVMRRM-GHTDPHVVMQAITLL 70
            |:|....:||||..:..:::|:|.:::||.:.......||.::|:.:|: |:.:...||.|:|:|
Human    10 STPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVL 74

  Fly    71 DALSNNCGKPLHLEVASRDFETEFRRLLAK-AQPK------VSLKMRQVLKNWAENDYKNDRELD 128
            :....|||...|:.||:|||   ...:|.| ..||      |..|:..:::.||: .:::..:|.
Human    75 ETCVKNCGHRFHILVANRDF---IDSVLVKIISPKNNPPTIVQDKVLALIQAWAD-AFRSSPDLT 135

  Fly   129 LIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSP 193
            .:..:|.:|:::|.:|         .:|:..|..|    :.:.|:...::..|..:...:::...
Human   136 GVVHIYEELKRKGVEF---------PMADLDALSP----IHTPQRSVPEVDPAATMPRSQSQQRT 187

  Fly   194 KTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALYDFEAAEENELTFFAGEI 258
            ..||.:|..     |:.|        |||.|.|.|...|    :.|..:..|...:||....|..
Human   188 SAGSYSSPP-----PAPY--------SAPQAPALSVTGP----ITANSEQIARLRSELDVVRGNT 235

  Fly   259 IHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLDINQQHKSAAAAGQR--ELDSAAALQ 321
                        |..::....:.|....::||.:      :.:.:::..|..||  ||.|..:.:
Human   236 ------------KVMSEMLTEMVPGQEDSSDLEL------LQELNRTCRAMQQRIVELISRVSNE 282

  Fly   322 QKTEAAAAAAAAQPVEIDESKIDRLLHLLHEAN 354
            :.||                   .|||:..:.|
Human   283 EVTE-------------------ELLHVNDDLN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 40/151 (26%)
SH3_STAM 235..288 CDD:212754 7/52 (13%)
GAT 340..412 CDD:281166 4/15 (27%)
TOM1L2NP_001337261.1 VHS_Tom1L2 12..148 CDD:340793 39/139 (28%)
GAT_TM1L2 218..309 CDD:260096 20/116 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1213216at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.