DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and AURKB

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001271455.1 Gene:AURKB / 9212 HGNCID:11390 Length:345 Species:Homo sapiens


Alignment Length:319 Identity:146/319 - (45%)
Similarity:205/319 - (64%) Gaps:24/319 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RNHLPHLLAKVPEE--HQEPIKNMCLKMMS---------------HDAYGQPYDWSPR-----DF 53
            |...|..|:.:|:.  .:||:....|.:||               .::.|.|...:.|     ||
Human    14 RQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRRHFTIDDF 78

  Fly    54 EMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLT 118
            |:|..||:||||.||||||:.||::||:||:||.::.|..|:.|:.||||||:.|.||:||||..
Human    79 EIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYN 143

  Fly   119 WFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPEN 183
            :|:|..||||.||.|..|||:|.|:  .:..|||.|:|....::|:||.|||...|||||:||||
Human   144 YFYDRRRIYLILEYAPRGELYKELQ--KSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPEN 206

  Fly   184 ILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGC 248
            :||....:||:||||||.|.|:.:|:|:|||||||||||::|..:::.||.||:|:||||.:||.
Human   207 LLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGN 271

  Fly   249 PPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWVKA 307
            |||||.|...||.:|.::::.:|:.:..|.::||..|||.....|:.|..|..|.||:|
Human   272 PPFESASHNETYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSERLPLAQVSAHPWVRA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 132/253 (52%)
AURKBNP_001271455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 2/7 (29%)
PKc_like 71..340 CDD:304357 135/262 (52%)
S_TKc 78..328 CDD:214567 130/251 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - LDO PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.