DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and IPL1

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_015115.1 Gene:IPL1 / 855892 SGDID:S000006130 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:132/307 - (42%)
Similarity:193/307 - (62%) Gaps:11/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSRAKHANRNHLPHLLAKVPEEHQEPIKNMCLKMMSHDAYGQP--YDWSPRDFEMGAHLGRGKFG 65
            |:|....|:..|....:|:|    .||:......|.|:....|  ...|..|||:|..||:||||
Yeast    56 LNRLPVNNKKFLDMESSKIP----SPIRKATSSKMIHENKKLPKFKSLSLDDFELGKKLGKGKFG 116

  Fly    66 RVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLAL 130
            :||..|.|.:.|:.|:|||.|||:.|..:|:|..||:|||:.|.||::.:...:||||.|:||.:
Yeast   117 KVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLM 181

  Fly   131 EIASEGELFKHLR-GAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKL 194
            |....||::|.|| ..|   |::..::.|.||:||||:|.|..|:||||:||||||:...:.:||
Yeast   182 EYLVNGEMYKLLRLHGP---FNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKL 243

  Fly   195 ADFGWS-AHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTES 258
            .||||| .:.|.|:|:|:|||:|||.||||:...||.::|.|.||:|.:|.:.|.||||....::
Yeast   244 TDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDT 308

  Fly   259 TYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWV 305
            ||.:|..::|..||::|:..::||..||:.:.|.|:.|.||..|.|:
Yeast   309 TYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 120/256 (47%)
IPL1NP_015115.1 STKc_Aurora 118..356 CDD:270909 110/241 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I347
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 1 1.000 - - otm46627
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - LDO PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.