DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and AUR3

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_182073.1 Gene:AUR3 / 819157 AraportID:AT2G45490 Length:288 Species:Arabidopsis thaliana


Alignment Length:276 Identity:136/276 - (49%)
Similarity:185/276 - (67%) Gaps:5/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MCLKMMSHDAYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQR 96
            |..|....||......||..|||:|..||:|||||||||||..|.|:||:||:|||::.|..:..
plant     1 MSKKSTESDAGNTEKQWSLADFEIGRPLGKGKFGRVYLAREAKSKYIVALKVIFKEQIEKYKIHH 65

  Fly    97 QVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQ 161
            |:.||:|||:.|:||:||||..||||..||:|.||.|..|||:..|:  .|....|.::|.|...
plant    66 QLRREMEIQTSLRHPNILRLFGWFHDNERIFLILEYAHGGELYGVLK--QNGHLTEQQAATYIAS 128

  Fly   162 VANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGN 226
            ::.||.|||...|||||:||||:||.....||:||||||..: :|||:|:|||||||.||||:..
plant   129 LSQALAYCHGKCVIHRDIKPENLLLDHEGRLKIADFGWSVQS-SNKRKTMCGTLDYLAPEMVENR 192

  Fly   227 SYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYP--SHLSKGCKELIGGLLRKE 289
            .:|.:||.|.||||||||:.|.||||:.|.:.|:.:|.::::|:|  .::|:..|.||..||.|:
plant   193 DHDYAVDNWTLGILCYEFLYGNPPFEAESQKDTFKRILKIDLSFPLTPNVSEEAKNLISQLLVKD 257

  Fly   290 SKGRITLVDVMTHYWV 305
            ...|:::..:|.|.|:
plant   258 PSKRLSIEKIMQHPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 130/256 (51%)
AUR3NP_182073.1 STKc_Aurora 21..274 CDD:270909 130/256 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68302
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D954262at2759
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.