DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and AUR2

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001325078.1 Gene:AUR2 / 817129 AraportID:AT2G25880 Length:349 Species:Arabidopsis thaliana


Alignment Length:260 Identity:134/260 - (51%)
Similarity:184/260 - (70%) Gaps:5/260 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPH 112
            |:..||::|..|||||||.||||||:.|.::||:||:||.:|::..|:.|:.||:||||.|:||:
plant    81 WTTSDFDIGKPLGRGKFGHVYLAREKRSDHIVALKVLFKAQLQQSQVEHQLRREVEIQSHLRHPN 145

  Fly   113 ILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHR 177
            ||||..:|:|:.|:||.||.|..|||:|.|:..  ..|.|.|:|.|...:|.||.|||..:||||
plant   146 ILRLYGYFYDQKRVYLILEYAVRGELYKELQKC--KYFSERRAATYVASLARALIYCHGKHVIHR 208

  Fly   178 DLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCY 242
            |:||||:|:.:..:||:||||||.|| .|:|||:||||||||||||:...:|.|||.|.||||||
plant   209 DIKPENLLIGAQGELKIADFGWSVHT-FNRRRTMCGTLDYLPPEMVESVEHDASVDIWSLGILCY 272

  Fly   243 EFVVGCPPFESNSTESTYSKIRRMEISYPSH--LSKGCKELIGGLLRKESKGRITLVDVMTHYWV 305
            ||:.|.||||:.....||.:|.::::.:|..  :|...|:||..:|.|||..|:.|..::.|.|:
plant   273 EFLYGVPPFEAREHSETYKRIVQVDLKFPPKPIVSSSAKDLISQMLVKESTQRLALHKLLEHPWI 337

  Fly   306  305
            plant   338  337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 133/256 (52%)
AUR2NP_001325078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D954262at2759
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.