DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and aurkb

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_997731.2 Gene:aurkb / 791894 ZFINID:ZDB-GENE-020419-40 Length:320 Species:Danio rerio


Alignment Length:292 Identity:140/292 - (47%)
Similarity:200/292 - (68%) Gaps:20/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PEEH------QEPIKNMCLKMMSHDAYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVA 80
            |:.|      :.|:|:.. |::|.|           ||::|..||:||||.|||||||....::|
Zfish    28 PDTHAVSGPGRVPVKSNS-KVLSID-----------DFDIGRPLGKGKFGNVYLARERKLKVVIA 80

  Fly    81 MKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGA 145
            :||:||.::.|..|:.|:.|||||||.|:||:|||...:|||::|::|.||.|..||::|.|:..
Zfish    81 LKVLFKSQMVKEGVEHQLRREIEIQSHLRHPNILRFYNYFHDDTRVFLILEYAPRGEMYKELQRY 145

  Fly   146 PNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRT 210
            .:  ||:.|:|.|..:|::||.|||...|||||:||||:||....:||:||||||.|.|:.:|||
Zfish   146 GH--FDDQRTATYMEEVSDALQYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRT 208

  Fly   211 LCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLS 275
            :|||||||||||::|:|:|:.||.|.:|:||||.:||.||||:.|...||.:|.::::.:|..:|
Zfish   209 MCGTLDYLPPEMIEGHSHDEKVDLWSIGVLCYECLVGNPPFETASHAETYKRITKVDLQFPKLVS 273

  Fly   276 KGCKELIGGLLRKESKGRITLVDVMTHYWVKA 307
            :|.::||..|||.....|:.|..||.|.||||
Zfish   274 EGARDLISKLLRHSPSMRLPLRSVMEHPWVKA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 130/253 (51%)
aurkbNP_997731.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 2/9 (22%)
STKc_Aurora-B_like 46..315 CDD:271019 136/273 (50%)
S_TKc 53..303 CDD:214567 128/251 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.