DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and Aurkc

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_038959704.1 Gene:Aurkc / 292554 RGDID:1309573 Length:329 Species:Rattus norvegicus


Alignment Length:255 Identity:133/255 - (52%)
Similarity:192/255 - (75%) Gaps:2/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRL 116
            |||:|..|||||||||||||.:.:|::||:||:||.|:.|..::.|:.||:||||.|:||:||||
  Rat    62 DFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIGKEGLEHQLRREVEIQSHLQHPNILRL 126

  Fly   117 LTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKP 181
            ..:|:|:||:||.||.|..|||:|.|:  .|.:.::.|:|....::::||.|||.|.||||||||
  Rat   127 YNYFYDDSRVYLILEYAPRGELYKELQ--RNQKLNQQRTATIIEELSDALIYCHRNKVIHRDLKP 189

  Fly   182 ENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVV 246
            ||:||....::|:||||||.|||:.:|:|:|||||||||||::|.||:::||.||:|:||||.:|
  Rat   190 ENLLLGLKGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGKSYNETVDLWCIGVLCYELLV 254

  Fly   247 GCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWVK 306
            |.|||||:::..|..:|.:::..:||.:..|.::||..|||.....|::|..|:.|.||:
  Rat   255 GKPPFESSTSSETCRRICQVDFRFPSSMPAGAQDLISKLLRHHPSERLSLAQVLKHPWVR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 132/253 (52%)
AurkcXP_038959704.1 PKc_like 56..325 CDD:419665 133/255 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.