DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and Aurka

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_695208.2 Gene:Aurka / 261730 RGDID:628895 Length:397 Species:Rattus norvegicus


Alignment Length:264 Identity:137/264 - (51%)
Similarity:198/264 - (75%) Gaps:2/264 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPH 112
            |:..||::|..||:||||.||||||:.|.:::|:||:||.:|.|..|:.|:.||:||||.|:||:
  Rat   121 WTLEDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSHLRHPN 185

  Fly   113 ILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHR 177
            ||||..:|||.:|:||.||.|..|.:::.|:..  .:|||.|:|.|..::||||:|||...||||
  Rat   186 ILRLYGYFHDATRVYLILEYAPLGTVYRELQKL--SKFDEQRTATYITELANALSYCHSKRVIHR 248

  Fly   178 DLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCY 242
            |:||||:||.|..:||:||||||.|.|:::|.|||||||||||||::|..:|:.||.|.||:|||
  Rat   249 DIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCY 313

  Fly   243 EFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWVKA 307
            ||:||.||||:::.:.||.:|.|:|.::|..:::|.::||..||:..|..|:||.:|:.|.|:||
  Rat   314 EFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNSSQRLTLAEVLEHPWIKA 378

  Fly   308 GMAE 311
            ..::
  Rat   379 NSSK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 134/253 (53%)
AurkaNP_695208.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
STKc_Aurora-A 120..376 CDD:271018 134/256 (52%)
Activation segment. /evidence=ECO:0000250|UniProtKB:O14965 273..286 7/12 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..397 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.