DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and gad8

DIOPT Version :10

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_588010.1 Gene:gad8 / 2539206 PomBaseID:SPCC24B10.07 Length:569 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:88/248 - (35%)
Similarity:132/248 - (53%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLL 117
            ||:...:|:|.||:|...|:|.:..:.|:|.|.|..:.........|.|..:.:::.:|.|:.|.
pombe   230 FELLKVVGKGSFGKVMQVRKRDTSRIYALKTMKKAHIVSRSEVDHTLAERTVLAQVNNPFIVPLK 294

  Fly   118 TWFHDESRIYLALEIASEGELFKHLR--GAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLK 180
            ..|....::||.|...:.||||.||:  |.    ||..|:..|..::..||...|..|||:||||
pombe   295 FSFQSPGKLYLVLAFVNGGELFHHLQREGC----FDTYRAKFYIAELLVALECLHEFNVIYRDLK 355

  Fly   181 PENILLTSTDDLKLADFGW----SAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILC 241
            ||||||..|..:.|.|||.    .|.|  ::..|.|||.:||.||::.|:.|...||.|.||:|.
pombe   356 PENILLDYTGHIALCDFGLCKLNMAKT--DRTNTFCGTPEYLAPELLLGHGYTKVVDWWTLGVLL 418

  Fly   242 YEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRI 294
            ||.:.|.|||...:....|.||.:..:.:|.::.:..|:|:.|||.:..:.|:
pombe   419 YEMITGLPPFYDENINEMYRKILQDPLRFPDNIDEKAKDLLSGLLTRAPEKRL 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 88/248 (35%)
gad8NP_588010.1 YPK1_N_like 66..225 CDD:212165
STKc_YPK1_like 235..547 CDD:270737 86/243 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.