DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and Aurkb

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_035626.1 Gene:Aurkb / 20877 MGIID:107168 Length:345 Species:Mus musculus


Alignment Length:264 Identity:132/264 - (50%)
Similarity:190/264 - (71%) Gaps:4/264 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRL 108
            ||:  :..:||:|..||:||||.||||||:.|.::||:|::||.::.|..|:.|:.||||||:.|
Mouse    75 QPF--TIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHL 137

  Fly   109 KHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNN 173
            |||:||:|..:|:|:.||||.||.|..|||:|.|:  .:..|||.|:|....::::||.|||...
Mouse   138 KHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQ--KSRTFDEQRTATIMEELSDALTYCHKKK 200

  Fly   174 VIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLG 238
            |||||:||||:||....:||:||||||.|.|:.:|:|:|||||||||||::|..:::.||.||:|
Mouse   201 VIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIG 265

  Fly   239 ILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHY 303
            :||||.:||.|||||.|...||.:|.::::.:||.:..|.::||..||:.....|:.|.:|..|.
Mouse   266 VLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKLLKHNPWQRLPLAEVAAHP 330

  Fly   304 WVKA 307
            ||:|
Mouse   331 WVRA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 128/253 (51%)
AurkbNP_035626.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..77 1/1 (100%)
PKc_like 77..344 CDD:304357 130/262 (50%)
S_TKc 82..332 CDD:214567 127/251 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - LDO PTHR24350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2391
SonicParanoid 1 1.000 - - X555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.