DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and Pim2

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_613072.1 Gene:Pim2 / 18715 MGIID:97587 Length:370 Species:Mus musculus


Alignment Length:279 Identity:82/279 - (29%)
Similarity:126/279 - (45%) Gaps:22/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEE-LRKGCVQRQVLREIEIQSRLK------ 109
            ::.:|..||:|.||.|:..........||:||:.:.. |....|...|...:|:....|      
Mouse    90 EYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWSTVSDSVTCPLEVALLWKVGEGNG 154

  Fly   110 HPHILRLLTWFHDESRIYLALEIASEG-ELFKHL--RGAPNHRFDEPRSAKYTYQVANALNYCHL 171
            ||.::|||.||.......|.||..... :||.::  :|.    ..|..|..:..||..|:.:||.
Mouse   155 HPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGP----LGESCSRSFFTQVVAAVQHCHA 215

  Fly   172 NNVIHRDLKPENILL-TSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDD-SVDQ 234
            ..|:|||:|.||||: .....:||.|||..|...:.......||..|.|||.:..:.|.. ....
Mouse   216 RGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATV 280

  Fly   235 WCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDV 299
            |.||:|.|:.|.|..|||.:      .:|...|:.:|:|:|..|..||...|..:...|.:|.::
Mouse   281 WSLGVLLYDMVCGDIPFERD------QEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEI 339

  Fly   300 MTHYWVKAGMAERELQLQK 318
            :...|:::...|:.:...|
Mouse   340 LLDPWMQSPAEEKPINSSK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 80/265 (30%)
Pim2NP_613072.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..83
PKc_like 90..346 CDD:304357 80/265 (30%)
S_TKc 91..345 CDD:214567 79/263 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..370 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2612
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.