DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and air-1

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_505119.1 Gene:air-1 / 179202 WormBaseID:WBGene00000098 Length:326 Species:Caenorhabditis elegans


Alignment Length:284 Identity:127/284 - (44%)
Similarity:189/284 - (66%) Gaps:8/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MSHDAYGQPYD-------WSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCV 94
            ::.|:..|..|       ||..||::|..||:||||.|:::||:.:..::|:||:||.:|.:..|
 Worm    21 LTEDSRPQRVDQAREESCWSLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGV 85

  Fly    95 QRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYT 159
            ..|:.||||||..|:||:||.|..:|||:.|:::.|:.||.||||..|:..|.|:.:|..:.::.
 Worm    86 SHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFV 150

  Fly   160 YQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVD 224
            .|:||||:|||...|||||:||||:||.|..:|||||||||....::||.|||||:|||.||||.
 Worm   151 RQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVS 215

  Fly   225 GNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKE 289
            ...:|.:||.|.:|||.:|.:||..||.:.:.:...::|:..:|..||.::.|...||..:::||
 Worm   216 NQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKE 280

  Fly   290 SKGRITLVDVMTHYWVKAGMAERE 313
            .:.|:.|||:|.|.|:|. |.:||
 Worm   281 PQERLPLVDIMAHPWIKE-MKQRE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 118/253 (47%)
air-1NP_505119.1 STKc_Aurora 43..297 CDD:270909 118/253 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - O PTHR24350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X555
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.