DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aurB and Aurkb

DIOPT Version :9

Sequence 1:NP_477336.1 Gene:aurB / 34504 FlyBaseID:FBgn0024227 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_446201.1 Gene:Aurkb / 114592 RGDID:621625 Length:343 Species:Rattus norvegicus


Alignment Length:264 Identity:133/264 - (50%)
Similarity:189/264 - (71%) Gaps:4/264 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRL 108
            ||:  :..:||:|..||:||||.||||||:.|.::||:|::||.::.|..|:.|:.||||||:.|
  Rat    73 QPF--TIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHL 135

  Fly   109 KHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNN 173
            |||:||:|..:|:|:.||||.||.|..|||:|.|:  .:..|||.|:|....::::||.|||...
  Rat   136 KHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQ--KSGTFDEQRTATIMEELSDALMYCHKKK 198

  Fly   174 VIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLG 238
            |||||:||||:||....:||:||||||.|.|:.:|:|:|||||||||||::|..:::.||.||:|
  Rat   199 VIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIG 263

  Fly   239 ILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHY 303
            :||||.:||.|||||.|...||.:|.::::.:||.:..|.|:||..||:.....|:.|..|..|.
  Rat   264 VLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSMPLGAKDLISKLLKHNPSQRLPLEQVSAHP 328

  Fly   304 WVKA 307
            ||:|
  Rat   329 WVRA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aurBNP_477336.1 STKc_Aurora 52..306 CDD:270909 129/253 (51%)
AurkbNP_446201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
STKc_Aurora-B_like 75..342 CDD:271019 131/262 (50%)
S_TKc 80..330 CDD:214567 128/251 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318112at33208
OrthoFinder 1 1.000 - - FOG0000946
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100573
Panther 1 1.100 - - LDO PTHR24350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X555
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.