DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dnz1 and AKR2

DIOPT Version :9

Sequence 1:	NP_477449.1	Gene:	Dnz1 / 34503	FlyBaseID:	FBgn0027453	Length:	276	Species:	Drosophila melanogaster
Sequence 2:	NP_014677.1	Gene:	AKR2 / 854199	SGDID:	S000005560	Length:	749	Species:	Saccharomyces cerevisiae

Alignment Length:	144	Identity:	39/144 - (27%)
Similarity:	56/144 - (38%)	Gaps:	42/144 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 MSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFS------------DLHTTNKNNPPPG 94
            :.|.|..|.|||..|     :.|.||||.:     :.|.|            ||...::.|
Yeast   396 VQFLVTSFLTVVLFL-----RLVRSDPGCL-----KTDDSLTSIQETIKQLIDLGKFDREN---- 446

  Fly    95 NGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSL 159
                    .|......:|.|:.:.......:.|.||:||||.|.||.:|.|.|:.|.:.|.
Yeast   447 --------FCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTVQ---- 499

  Fly   160 YSIALIVGSWVWPC 173
            |.:.|    ::|.|
Yeast   500 YHMFL----FMWLC 509

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dnz1	NP_477449.1	DHHC	97..228	CDD:396215	22/77 (29%)
AKR2	NP_014677.1	ANKYR	1..195	CDD:223738
		ANK repeat	54..81	CDD:293786
		ANK repeat	83..115	CDD:293786
		ANK repeat	117..148	CDD:293786
		ANK repeat	189..220	CDD:293786
		Ank_4	190..243	CDD:372654
		ANK repeat	222..247	CDD:293786
		COG5273	340..711	CDD:227598	39/144 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810