DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:231 Identity:62/231 - (26%)
Similarity:96/231 - (41%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTV--- 103
            ::|.:::..:::..||:|     ..|||.|.:                .|.|......|.|.   
Human   103 LTFLLLVLGSLLLYLAVS-----LMDPGYVNV----------------QPQPQEELKEEQTAMVP 146

  Fly   104 -------CTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYS 161
                   |..|...:|.||.|||.|:||:||.||||||:.|||||||...|:.:|....::.|:.
Human   147 PAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWG 211

  Fly   162 IALI---------VGSWVWPCEECSQNVIETQLR---MIHSVILMLVSALFGLFVTAIMVDQLHA 214
            :.|.         .|.|               ||   ::.:..|:|  :||.|..:.::|..|:.
Human   212 LYLAWSGLRFFQPWGQW---------------LRSSGLLFATFLLL--SLFSLVASLLLVSHLYL 259

  Fly   215 ILYDETAVEAIQQKGTYRPNRRKY--QLLADVFGRG 248
            :..:.|..|.|..      :|..|  |..::.|.||
Human   260 VASNTTTWEFISS------HRIAYLRQRPSNPFDRG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 46/152 (30%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.