DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:110/252 - (43%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFH-----------VVLFNTVVFLLAMS-H 60
            ||...::..:|.|    :.:...:||||.  .|:..|.           :.:...::|...|| .
Human    81 CGGRLMLAGHGGV----FALTLLLILTTT--GLFFVFDCPYLARKLTLAIPIIAAILFFFVMSCL 139

  Fly    61 SKAVFSDPGTVP----LPANRLDFSDLHTTNKN--NPPPG------NGHSSEWTVCTRCETYRPP 113
            .:..|:|||.:|    ..|..|: ..:..|..:  .|||.      ||...:...|..|:.:|||
Human   140 LQTSFTDPGILPRATVCEAAALE-KQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPP 203

  Fly   114 RAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQ 178
            |..||.:|..|:.|.||||||:.||||.||.::|..|::.::.|:.:..|.:|.......:  ..
Human   204 RTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQ--GS 266

  Fly   179 NVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNR 235
            |.:.| |:...:.:|.||...|.:: :.:.:...|..|...........||::...|
Human   267 NFLST-LKETPASVLELVICFFSIW-SILGLSGFHTYLVASNLTTNEDIKGSWSSKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 37/130 (28%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 37/126 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.