DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT4G24630

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_194194.2 Gene:AT4G24630 / 828565 AraportID:AT4G24630 Length:407 Species:Arabidopsis thaliana


Alignment Length:270 Identity:70/270 - (25%)
Similarity:102/270 - (37%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPL 73
            |.|.:||   |:|:..||:|                  :||.|..            .|||.||.
plant    62 GYAIMVV---AILFTIYVLI------------------LLFFTSA------------RDPGIVPR 93

  Fly    74 ----PANRLDFSDLHTTNKNNPPP----------GNGHSSEWTVCTRCETYRPPRAHHCRICKRC 124
                |...|.:....:.:....|.          .||.|.....|..|..|||||..||.||..|
plant    94 NSHPPEEDLRYETTVSADGRQTPSVQIPRTKEVIVNGVSVRVKYCDTCMLYRPPRCSHCSICNNC 158

  Fly   125 IRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIH 189
            :.|.||||||:..|:|.||.:||..|:....||.:|..              |.:.:..::.|.|
plant   159 VERFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCIYIF--------------SMSAVYIKILMDH 209

  Fly   190 --------------SVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQL 240
                          :|:||:...:...||..:....|:.|..::|..|.::    ||.:..:   
plant   210 QQATVWRAMKESPWAVVLMIYCFIALWFVGGLTAFHLYLISTNQTTYEKLR----YRSSHSR--- 267

  Fly   241 LADVFGRGHP 250
             :.|:.||.|
plant   268 -SIVYNRGCP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 42/144 (29%)
AT4G24630NP_194194.2 zf-DHHC 136..261 CDD:279823 41/142 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.