DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT3G56930

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_191252.1 Gene:AT3G56930 / 824860 AraportID:AT3G56930 Length:477 Species:Arabidopsis thaliana


Alignment Length:226 Identity:63/226 - (27%)
Similarity:95/226 - (42%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VFLLAMSHSKAVFSDPGTVP---LPANRLDFSDLHTTNK---NNPPPG-----------NGHSSE 100
            :|.|.|:.|:    |||.||   .|....|..|..|.:.   :...|.           |||:.:
plant    84 IFFLLMTSSR----DPGIVPRSFRPPETDDAPDSTTPSMEWVSGRTPNIRIPRVKDVTVNGHTVK 144

  Fly   101 WTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALI 165
            ...|..|..||||||.||.||..|::|.||||||:..|:|.||.::|..|:.....|.:|..|. 
plant   145 VKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIGVRNYRFFFMFISTSTTLCIYVFAF- 208

  Fly   166 VGSW-------------VWPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILY 217
              ||             :|  :..|::|:        |.||::...:...||..:.:...:.|..
plant   209 --SWLNIFQRHMDEKISIW--KAISKDVL--------SDILIVYCFITVWFVGGLTIFHSYLICT 261

  Fly   218 DETAVEAIQQKGTYRPNRRKYQLLADVFGRG 248
            ::|         ||...|.:|....:.:.:|
plant   262 NQT---------TYENFRYRYDKKENPYNKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 42/143 (29%)
AT3G56930NP_191252.1 DHHC 146..271 CDD:396215 43/146 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.