DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT3G56920

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_191251.2 Gene:AT3G56920 / 824859 AraportID:AT3G56920 Length:338 Species:Arabidopsis thaliana


Alignment Length:228 Identity:60/228 - (26%)
Similarity:91/228 - (39%) Gaps:76/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVP--LPANRLDFSDLHTTNKNNPPPGNGH 97
            |:.|::.::|....|      |.::.|:    |||.:|  ...:..:..|:.|           .
plant    69 TLIGAILLTFMAFTF------LFLTSSR----DPGIIPRNKQVSEAEIPDVTT-----------Q 112

  Fly    98 SSEWTV-------------------------CTRCETYRPPRAHHCRICKRCIRRMDHHCPWINN 137
            |:||..                         |..|:.||||||.||.||..|::|.||||||:..
plant   113 STEWVTSKLGSVKLPRTKDVMVNGFTVKVKFCDTCQLYRPPRAFHCSICNNCVQRFDHHCPWVGQ 177

  Fly   138 CVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHS---VILM--LVS 197
            |:..||..:|:.||....||.:|   :.|.|||             .:..:|.   |:|.  |:.
plant   178 CIALRNYPFFVCFLSCSTLLCIY---VFVFSWV-------------SMLKVHGEFYVVLADDLIL 226

  Fly   198 ALFGL-------FVTAIMVDQLHAILYDETAVE 223
            .:.||       ||..:.|...:.|..::|..|
plant   227 GVLGLYCFVSVWFVGGLTVFHFYLICTNQTTCE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 48/164 (29%)
AT3G56920NP_191251.2 zf-DHHC 142..263 CDD:279823 45/134 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.