DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT3G48760

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_190445.2 Gene:AT3G48760 / 824037 AraportID:AT3G48760 Length:476 Species:Arabidopsis thaliana


Alignment Length:269 Identity:62/269 - (23%)
Similarity:114/269 - (42%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IACLVVTYGAVLYADYVVIRWI----------ILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAV 64
            |...::|...:::..:|..::|          :|....|       ::|.:.|..||..:.    
plant    56 ITVFLITAPVIVFCIFVGRKFIDDFPHHRGVSVLAVAVG-------LILLDLVFLLLTSAR---- 109

  Fly    65 FSDPGTVPLPANRLDFSDLHTTNKNNPPPG-----------------NGHSSEWTVCTRCETYRP 112
              |||.:|    |..:.....:|:.|..|.                 ||.:.:...|..|..|||
plant   110 --DPGIIP----RNLYPPEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCMLYRP 168

  Fly   113 PRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWP---CE 174
            |||.||.||..|:.:.||||||:..|:|.||.:::..|::...||.:|   :.|..|::.   .:
plant   169 PRASHCSICNNCVEKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIY---VHVFCWIYVKRIMD 230

  Fly   175 ECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQ 239
            ..:.|:.::.|:...|:.|::.:.:...||..:....|:.:..:::         ||...|.:|.
plant   231 SENINIWKSFLKTPASIALIIYTFICVWFVGGLTCFHLYLMSTNQS---------TYENFRYRYD 286

  Fly   240 LLADVFGRG 248
            ...:.|.:|
plant   287 RHENPFNKG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 36/133 (27%)
AT3G48760NP_190445.2 zf-DHHC 153..283 CDD:279823 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.