DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT3G18620

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:311 Identity:79/311 - (25%)
Similarity:124/311 - (39%) Gaps:75/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPG 69
            ||.|.:..|.|               .:|..:.|.:|.::.|        |.::|.:..:|....
plant    64 RDRCFVVILAV---------------FMLFVICGGIWAAYPV--------LFSISLACGIFHSVT 105

  Fly    70 TVPLPANRLDFSDL-------HTTN---KNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRC 124
            |..|..:.|....|       ..||   ..:|..|||..:.:|.|..|...:.||.||||.|..|
plant   106 TATLAISTLSTFILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMC 170

  Fly   125 IRRMDHHCPWINNCVGERNQKYFLQFLI-------YVALLSLYSIALIVGSWVWPCEECSQNVIE 182
            :..||||||:|.||||..|.|||:.|||       |.|::.:|::..|:.    |.|:.:....:
plant   171 VLDMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILP----PIEKGAAYASD 231

  Fly   183 TQ----------LRMIHSVILMLVS----------ALFGLFVTAIMV---------DQLHAILYD 218
            ..          ||::.::.|..::          .|..|||.::.|         .||..|...
plant   232 VAHVAHGNSISILRVVKNICLTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEG 296

  Fly   219 ETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLPCTSLNHASRYHDT 269
            :|.:..:..:||.....:..:.|...||..|.....||  ::.:..:.|.|
plant   297 KTYLSHLSSQGTEEDGEKSCRNLLTFFGCPHSIERHLP--TIRNLRKRHKT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 47/166 (28%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 49/150 (33%)
DHHC 149..298 CDD:396215 45/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.