DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and AT3G04970

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:231 Identity:67/231 - (29%)
Similarity:102/231 - (44%) Gaps:59/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVVTYGAVLYADYVVIRWIILTTMPG------SLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTV 71
            |.|.|.|::.:.|.:........:||      ..:.||..|:...::|||      ..|||||||
plant    80 LQVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAVIVGVILFLL------TCFSDPGTV 138

  Fly    72 PLP-----ANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHH 131
            ...     .:...:.|:..:.|.              |:.|:..:|.|:.||.||.||:.|.|||
plant   139 NAENVSRYISAYPYDDIIYSKKE--------------CSTCKIPKPARSKHCSICNRCVARFDHH 189

  Fly   132 CPWINNCVGERNQKYFLQFLIYVALLSLY---SIALIVGSWVWPCEECSQNVIETQLRMIH---- 189
            |.|:|||:||||.|||:.||::..||.||   :|..|:...|            .:||::|    
plant   190 CGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRV------------KELRVVHILTV 242

  Fly   190 ---------SVILMLVSALFGLFVTAIMVDQLHAIL 216
                     |:...::..|.|.:.|.|::....||:
plant   243 YYGVDKSFRSLAPRVIQWLVGTYNTQILLMVFLAIV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 45/136 (33%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 48/147 (33%)
DHHC 155..305 CDD:366691 46/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.