DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC11

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens


Alignment Length:325 Identity:67/325 - (20%)
Similarity:110/325 - (33%) Gaps:103/325 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TYGAVLYADYVVIRW-IILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPG---------- 69
            |:|  ::..::...| .|...:.|.:: |||:|:           |..|...||.          
Human    56 TFG--IFIPFLPHAWKYIAYVVTGGIF-SFHLVV-----------HLIASCIDPADSNVRLMKNY 106

  Fly    70 TVPLP-------ANRLDFSDLH---TTNKNNPPPGNGHSSEWTVCTRCETYRPPR---------- 114
            :.|:|       |:.:.....|   .|...:|||.: ||....:........|||          
Human   107 SQPMPLFDRSKHAHVIQNQFCHLCKVTVPQHPPPAS-HSLLDALSPGRTGLVPPRHLASSDGPLA 170

  Fly   115 ----AH------------------HCRICKRCIRRMDHHCPWINNCVGERNQKYFLQ-------- 149
                ||                  ||..|.:|:...||||.|||||||.||..:|..        
Human   171 LPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAG 235

  Fly   150 FLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQ-----LRMIHSVILMLVSALFGLFVTAIMV 209
            .|..:|:|....:..:|...|...:...::|....     |.:....:..|:..:.|:.|  :::
Human   236 MLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLV--LLL 298

  Fly   210 DQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLPCTSLNHASRYHDTPLLSH 274
            |.|..:...:..:..|            |..::.......|..|::...        |.||||.:
Human   299 DFLGLVHLGQLLIFHI------------YLSMSPTLSPRSPQGWVVRAA--------HLTPLLEY 343

  Fly   275  274
            Human   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/175 (22%)
ZDHHC11XP_016865358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.