DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:204 Identity:54/204 - (26%)
Similarity:85/204 - (41%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RDPCGIACLVVTYGAVLYAD-----------------YVVIRWIILTTMPGSLWMSFHVVLFNTV 52
            |.|..|...::..|.| ||:                 |:::.:::|:.              |.|
Mouse    64 RHPTFIVLHLLLQGLV-YAEYTCEVFGYCRELEFSLPYLLLPYVLLSV--------------NLV 113

  Fly    53 VFLLAMSHSKAVFSDPGTVPLPANR------LDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYR 111
            .|.|..:      ::|||: ..||.      ..|.|:..       |.|..      |..|:..:
Mouse   114 FFTLTCA------ANPGTI-TKANESFLLQVYKFDDVMF-------PKNSR------CPTCDLRK 158

  Fly   112 PPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEEC 176
            |.|:.|||:|.||:.|.||||.|:|||:|..|.:|||.:|:.:. .|..:||.:..:::......
Mouse   159 PARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTLT-ASAATIATVTAAFLLRLVTV 222

  Fly   177 SQNVIETQL 185
            |....||.|
Mouse   223 SDLYQETYL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 32/89 (36%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 32/82 (39%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.