Sequence 1: | NP_477449.1 | Gene: | Dnz1 / 34503 | FlyBaseID: | FBgn0027453 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082655.1 | Gene: | Zdhhc4 / 72881 | MGIID: | 1920131 | Length: | 343 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 54/204 - (26%) |
---|---|---|---|
Similarity: | 85/204 - (41%) | Gaps: | 59/204 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 RDPCGIACLVVTYGAVLYAD-----------------YVVIRWIILTTMPGSLWMSFHVVLFNTV 52
Fly 53 VFLLAMSHSKAVFSDPGTVPLPANR------LDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYR 111
Fly 112 PPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEEC 176
Fly 177 SQNVIETQL 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dnz1 | NP_477449.1 | DHHC | 97..228 | CDD:396215 | 32/89 (36%) |
Zdhhc4 | NP_082655.1 | DHHC | 151..292 | CDD:396215 | 32/82 (39%) |
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 | 340..343 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848324 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |