DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_081980.1 Gene:Zdhhc11 / 71164 MGIID:1918414 Length:347 Species:Mus musculus


Alignment Length:282 Identity:62/282 - (21%)
Similarity:107/282 - (37%) Gaps:87/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPG----- 69
            :|..:||:|            |.:..:|.|...:.::|:....:|.|.: |..|:..||.     
Mouse    53 LAMSIVTFG------------IFIPFLPYSWKYAANIVMGGVFIFHLIV-HLIAITIDPADTNVR 104

  Fly    70 -----TVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMD 129
                 |.|:||  .|.|. ||           |..:...|..||.....:|.||..|.:|:...|
Mouse   105 LKKDYTQPVPA--FDRSK-HT-----------HVIQNQYCHLCEVTASKKAKHCSACNKCVSGFD 155

  Fly   130 HHCPWINNCVGERNQKYF--------------LQFLIYVALL-----------SLYSIALIVGSW 169
            |||.|:|||||.||..:|              :..|.|:.:.           .||...:...:|
Mouse   156 HHCKWLNNCVGRRNYWFFFWSVASAAVGILGVMIILCYICIQYFVNPDELRTDPLYKEIISENTW 220

  Fly   170 -----VWPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKG 229
                 :||..      ::|.:.:..:|:.:|::....:.:..:::..|:.|..:.:..:.:.:  
Mouse   221 LLFLSLWPVP------VKTPIVLSIAVMALLLAIASFVMLGHLLIFHLYLITKNMSTFDYLMK-- 277

  Fly   230 TYRPNRRKYQLLADVFGRGHPA 251
                .|.|..|        |||
Mouse   278 ----TRFKKNL--------HPA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 34/160 (21%)
Zdhhc11NP_081980.1 zf-DHHC 123..277 CDD:279823 34/159 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.