DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001365935.1 Gene:Zdhhc1 / 70796 MGIID:1918046 Length:484 Species:Mus musculus


Alignment Length:248 Identity:70/248 - (28%)
Similarity:106/248 - (42%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VIRWIILTTMPGSLWMSFHVVLFNTVVFLL-------AMSHSKAVFSDPGTVPLPANRLDFSDLH 84
            ::.|:        |::.|.|:.|..:|.||       ..:...|:|:....|.|.|..:|.:|.:
Mouse    50 IVAWL--------LYLFFAVIGFGVLVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADAN 106

  Fly    85 TTNKNNPPP-------GNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGER 142
            ..:|:...|       .:.|..|...|..|:.....|:.||..|.:|:...||||.|:|||||||
Mouse   107 VRDKSYSGPLPIFNRSQHAHVIEDLHCNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGER 171

  Fly   143 NQKYFL----QFLIYVALLSLYSIALIVGSWVWPCE-------ECSQN------------VIETQ 184
            |.:.||    ..|:.|.||.|.:..:.|..:|.|..       |..:|            .:|||
Mouse   172 NYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNQHFEVLKNHTDVWFVFLPAAPVETQ 236

  Fly   185 LRMIHSVILMLVSALFGLFVTAIMVDQL--HAIL--YDETAVEAIQQKGTYRP 233
            ...|.::..:|:  |.||..||::...|  |..|  :..|..|.|.|   :||
Mouse   237 APAILALAALLI--LLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQ---HRP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 50/157 (32%)
Zdhhc1NP_001365935.1 Mediates interaction with STING1. /evidence=ECO:0000250|UniProtKB:Q8WTX9 1..268 63/227 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
DHHC 126..281 CDD:396215 50/156 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..415
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..484
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.