DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:112/248 - (45%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPL-PANRLDFSDLHTTNKNNPPPGNGH-------- 97
            |::| :||...|:    |:.|.:|    |:|: |:.....|..........|.|..|        
Mouse    56 MAYH-LLFAMFVW----SYWKTIF----TLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAA 111

  Fly    98 ----------SSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLI 152
                      |.....|.||:..:|.|.|||.:|.:||.:|||||||:|||||..|.|:||.||.
Mouse   112 KDLPIYTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLA 176

  Fly   153 YVALLSLYSIALIVGSWV--WPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAI 215
            |..|..|:..|..:..::  |     :..:.:||.: .|.:.|...:|:|.:.::::.......:
Mouse   177 YSLLYCLFIAATDLQYFIRFW-----TNGLPDTQAK-FHIMFLFFAAAMFSVSLSSLFGYHCWLV 235

  Fly   216 LYDETAVEAIQ----QKGTYRPNRRKYQL-----LADVFGRGHPALWLLPCTS 259
            ..:::.:||.:    :.||   ::..:.|     :..||| .....||||..|
Mouse   236 SKNKSTLEAFRNPVFRHGT---DKNGFSLGFSKNMRQVFG-DEKKYWLLPVFS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 44/154 (29%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 42/126 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.