DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:260 Identity:74/260 - (28%)
Similarity:120/260 - (46%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPL 73
            |:..:..|...:   |.|:..|.:.|| .||  ::| ::|.|..|.:| .::..|:|..||.|||
Human    29 GVIAICSTMAMI---DSVLWYWPLHTT-GGS--VNF-IMLINWTVMIL-YNYFNAMFVGPGFVPL 85

  Fly    74 ---PANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWI 135
               |....|...|.                  .|..|:.|:.||:||||.|.||:.:||||||||
Human    86 GWKPEISQDTMYLQ------------------YCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWI 132

  Fly   136 NNCVGERNQKYFLQFLI----------YVALLSLYSIALIVGSWVWPCEECSQNVIETQ-LRMIH 189
            |||.|.:|...|..||:          ::.::::|:......|:.|...:...:..... |.::.
Human   133 NNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAARRDPLPIVP 197

  Fly   190 SVILMLVSALFGLFV---TAIMVD-----QLHAILYDETAVEA-IQQKGTYRPNRRKYQLLADVF 245
            ..:....:.||.|.:   |.|.|.     |:..||.::|::|: |::|.   .:|.:|..|.:||
Human   198 FGLAAFATTLFALGLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKA---KDRIQYYQLDEVF 259

  Fly   246  245
            Human   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 44/150 (29%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 44/163 (27%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.