DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and zdhhc14

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:136 Identity:49/136 - (36%)
Similarity:72/136 - (52%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VLFNTVVFLLAMSHSKAVFSDPGTVP--LPANRLDFSDLHTTNKNNPPPG--------------N 95
            |||   ||::.|. .:|.|||||.:|  .|....|..  ...:.||.|.|              |
Zfish    99 VLF---VFVMGML-LRASFSDPGVLPRATPEEAADIE--RQIDANNGPSGPGYRPPPRTREVLIN 157

  Fly    96 GHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLY 160
            |.:.:...|..|:.:|||||.||.:|..|:.|.||||||:.||||.||.::|..|::.::.|:::
Zfish   158 GQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFILSLSFLTIF 222

  Fly   161 SIALIV 166
            ..|.::
Zfish   223 IFAFVI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 28/70 (40%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 28/66 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.