DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and zdhhc9

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001103496.1 Gene:zdhhc9 / 560095 ZFINID:ZDB-GENE-071004-8 Length:382 Species:Danio rerio


Alignment Length:220 Identity:70/220 - (31%)
Similarity:105/220 - (47%) Gaps:48/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FHVVLFNTVVFLLAMSHSKAVFSDPGTVP--LP--ANRLDFSDLHTTNKN-----NPPPG----- 94
            |.|:||   ||::||. .:..|||||.:|  ||  ||.::. ::...|.|     .|||.     
Zfish    67 FAVLLF---VFVMAML-LRTSFSDPGVLPRALPEEANFIEM-EIEAANGNVLAGQRPPPRIKNVQ 126

  Fly    95 -NGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLS 158
             |....:...|..|:.:|||||.||.||..|:.|.||||||:.||||:||.:||..|.:.::||:
Zfish   127 INNQIVKLKYCYTCKIFRPPRASHCSICDNCVDRFDHHCPWVGNCVGKRNYRYFYLFTLSLSLLT 191

  Fly   159 LYSIALIVGSWVWPCEECSQNVIETQLRMIHS-----------VILMLVSALFGLF-VTAIMVDQ 211
            :|..|.              :::...||.:.|           .:|.::...|.|: |..:....
Zfish   192 IYIFAF--------------DIVHVVLRSVDSGFVNTLKETPGTVLEVLVCFFTLWSVVGLTGFH 242

  Fly   212 LHAILYDETAVEAIQQKGTYRPNRR 236
            .:.|..::|..|.|  ||::....|
Zfish   243 TYLISLNQTTNEDI--KGSWSGKNR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 43/142 (30%)
zdhhc9NP_001103496.1 zf-DHHC 134..257 CDD:279823 43/138 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.