DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC4

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:226 Identity:53/226 - (23%)
Similarity:86/226 - (38%) Gaps:78/226 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VLYADYVVIRWIILTTMPGSLWMSFHVVLF-------NTVVFLLAMSHSKAVFSDPGTVPLPANR 77
            ::|.:|.   |.:..... .|.:|.|.:|.       |...|.|...      ::||.: ..||.
Human    78 MVYTEYT---WEVFGYCQ-ELELSLHYLLLPYLLLGVNLFFFTLTCG------TNPGII-TKANE 131

  Fly    78 LDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCR---------------ICKRCIRR 127
            |.|..::..::...|..       ..|:.|:..:|.|:.||.               :|..|:.|
Human   132 LLFLHVYEFDEVMFPKN-------VRCSTCDLRKPARSKHCSECGSRDSSGTSNSTCVCNWCVHR 189

  Fly   128 MDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVI 192
            .||||.|:|||:|..|.:|   |||||  |:|.:.|..|.            ::.|.. ::|.|:
Human   190 FDHHCVWVNNCIGAWNIRY---FLIYV--LTLTASAATVA------------IVSTTF-LVHLVV 236

  Fly   193 LMLVSALFGLFVTAIMVDQLHAILYDETAVE 223
            :                    :.||.||.::
Human   237 M--------------------SDLYQETYID 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 36/142 (25%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.