DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and CG5880

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:264 Identity:71/264 - (26%)
Similarity:104/264 - (39%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSH---SKAVFSDPGT 70
            |:|.|..:..::.|       ||.|...    |....:|.:    |||.:.:   ...||.....
  Fly    69 GVAALTTSVVSIAY-------WIGLPFW----WAKSQLVTY----FLLIVGNWLLLNVVFHYVMA 118

  Fly    71 VPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWI 135
            |..||             .:||.|.......::|.:|...:|||.|||.||.|||.:|||||||:
  Fly   119 VITPA-------------GHPPEGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWL 170

  Fly   136 NNCVGERNQKYFLQFLIYVALLSLYSI--ALIVG-SWVWPCEECSQNVIE------TQLRMIHSV 191
            |||||..|.:||..::.|..|..|:.|  .|.:| .::|.....:...||      .:..:...:
  Fly   171 NNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHI 235

  Fly   192 ILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLP 256
            |.:.....:..||....|..|...:.|..|..         |.||:             |||.:.
  Fly   236 IPVTHPNEYDEFVLPPAVHNLPTPIVDTDAAS---------PGRRR-------------ALWFMA 278

  Fly   257 CTSL 260
            .|::
  Fly   279 FTNV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 44/139 (32%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.