DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and CG17195

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:228 Identity:55/228 - (24%)
Similarity:86/228 - (37%) Gaps:58/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFS 81
            :|.:.|..|    ||::|.:.       |.:|.|.:                      |..:..|
  Fly    51 FGDIAYKLY----WILVTFIT-------HNILGNML----------------------ACYMTSS 82

  Fly    82 DLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKY 146
            .::|.:|::..|.......|..|..|:..|.||:.||.:|..||.|.||||.:...|:|..||::
  Fly    83 SVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRF 147

  Fly   147 FLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALF------GLFVT 205
            |..|..|:.|..:.|.|..       |....||  ......:.|||..|::..|      ..|.|
  Fly   148 FFWFTFYLTLGLVTSFATF-------CMFILQN--GGNFMSLSSVIFNLITRTFFQNYTGNTFET 203

  Fly   206 AIMVDQLHA-------ILYDETAVEAIQQKGTY 231
            ...:..:.|       :.|.   ::.:.|..||
  Fly   204 IAFLLNISASYMPAFMLAYQ---MQILSQNSTY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/143 (27%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.