DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and CG17196

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:280 Identity:67/280 - (23%)
Similarity:103/280 - (36%) Gaps:90/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VTYGAVLYADYVVIRWIILTTM----------PGSLWMSFHV----VLFNTVVFLLAMSH-SKAV 64
            |:.|..|...::::..:...|:          .|.::..|.:    ..:|.:..|||... |.||
  Fly    20 VSIGHPLSVIFLLVSTVFFFTLQVFYVAPDVHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAV 84

  Fly    65 FSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMD 129
            .|      ||..|           ..|.||..|.  |..|..|:...|||:.||.:||.||.:.|
  Fly    85 KS------LPQER-----------QIPKPGTEHL--WHYCDICQKLMPPRSWHCALCKCCILKRD 130

  Fly   130 HHCPWINNCVGERNQKYFLQFLIYVA---LLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSV 191
            |||.:...|:|..|.:||.....|:|   .:|:.::.:.||...:                    
  Fly   131 HHCIFAATCIGHNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFY-------------------- 175

  Fly   192 ILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWL-- 254
            :|..:.|.||..|.::                      :|   .|...|:.::|..|.|||.|  
  Fly   176 LLHRMKAGFGNTVKSL----------------------SY---FRYVCLILNIFALGFPALMLRF 215

  Fly   255 ------LPCTSLNHASRYHD 268
                  |..|....:||:||
  Fly   216 QVQILKLNSTYYQISSRHHD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 32/133 (24%)
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.