DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and CG17198

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster


Alignment Length:241 Identity:55/241 - (22%)
Similarity:101/241 - (41%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPCGIA---CLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSD 67
            |..|::   |:::.:       |....:.::....|....:.|.::...:|:.:           
  Fly    37 DIMGVSINVCIILFF-------YFFEAFYVMPQFLGLFGQAVHFLVTTWIVYNI----------- 83

  Fly    68 PGTVPLPANRLDFSDLHTTNKNNPP----PGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRM 128
                 |...||..:.|:|.: :.||    |..|....|..|..|:...|||:.||.||..||.:.
  Fly    84 -----LENLRLCVTTLNTVD-SLPPQMQQPMKGEEHLWHFCKICQRNVPPRSWHCNICDACILKR 142

  Fly   129 DHHCPWINNCVGERNQKYFLQFLIY------VALLSLYSIA---------LIVGSWVWPCEECSQ 178
            ||||.::.||||..||:||:.|..|      |||...:.:|         |:..:::  ......
  Fly   143 DHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVKANYI--IFNAYM 205

  Fly   179 NVIETQLRMIHSVILMLVSALF------GLFVTAIMVDQLHAILYD 218
            |....:|.:.:.::.:|...:|      .||.|.::....:::::|
  Fly   206 NPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVIKNSVMHD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 39/143 (27%)
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 41/156 (26%)
zf-DHHC 111..252 CDD:279823 39/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467578
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.