DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and CG13029

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster


Alignment Length:237 Identity:62/237 - (26%)
Similarity:98/237 - (41%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WMSFHVVLFNTVVFLLAM-SHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVC 104
            |:....:::|.:..:||. .:|.||.|      ||.:|           ..|.|...|.  |..|
  Fly    62 WLMALFIVYNLLGNMLACHRNSSAVTS------LPKDR-----------QIPCPEEKHL--WHFC 107

  Fly   105 TRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSW 169
            ..|:...|||:.||::|:.||.|.||||.:...|||..|.:||..|.:|:.:.||.|:|..|   
  Fly   108 DHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHV--- 169

  Fly   170 VWPCEECSQNVIETQLR----MIH-------------SVILMLVSALFGLF---VTAIMVDQLHA 214
                   :..:|:.|:|    ::|             .:|.:.:|.:..::   ::.||:.....
  Fly   170 -------NLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISFIINIYACILSLIMLGYQIP 227

  Fly   215 ILYDETAVEAIQQKGTYRPNRRKYQ--LLADVFG-RGHPALW 253
            .||..|..        |.|...:|.  ||.:... .|...||
  Fly   228 ALYLNTTF--------YTPKDYRYNQGLLGNFMAFMGKRGLW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 41/150 (27%)
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.