DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:268 Identity:79/268 - (29%)
Similarity:127/268 - (47%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIRDPCGIACLVVTYGAVLYADYVVIRWIILTT------MPGSLWMSFHVVLFNTVVFLLAMSHS 61
            |:.||.|..|:.:.....|| :.|:|..|:|..      :||.|     :::|..:.....::..
Human     7 FVVDPHGWCCMGLIVFVWLY-NIVLIPKIVLFPHYEEGHIPGIL-----IIIFYGISIFCLVALV 65

  Fly    62 KAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIR 126
            :|..:|||.:|                .||...:|....|.:|.:|...||.|:|||..|..|:|
Human    66 RASITDPGRLP----------------ENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVR 114

  Fly   127 RMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVW--PCEECSQNVIETQLRMIH 189
            |||||||||||||||.|...|||...|..||:.|::......:.:  |.::.:.::...:    |
Human   115 RMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFR----H 175

  Fly   190 SVILMLVSALFGLF----VTAIMVDQLHAILYDETAVEAIQQ--KGTYRPNRRKYQLLADVFGRG 248
            .:.:|.::|..|:.    :|.:...||..|:.|.|::|.:..  :...||.:...|..::|||..
Human   176 ELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTR 240

  Fly   249 HPALWLLP 256
            ...||.:|
Human   241 WKILWFIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 47/138 (34%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.